Lineage for d1tyeb2 (1tye B:107-354)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144673Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2144674Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2144675Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins)
  6. 2144736Protein Integrin beta A domain [69542] (1 species)
  7. 2144737Species Human (Homo sapiens) [TaxId:9606] [69543] (9 PDB entries)
    Uniprot P05106 27-716 ! Uniprot P05106 27-466
  8. 2144742Domain d1tyeb2: 1tye B:107-354 [112831]
    Other proteins in same PDB: d1tyea_, d1tyeb1, d1tyeb3, d1tyec_, d1tyed1, d1tyed3, d1tyee_, d1tyef1, d1tyef3
    complexed with ca, cac, mg, nag

Details for d1tyeb2

PDB Entry: 1tye (more details), 2.9 Å

PDB Description: structural basis for allostery in integrins and binding of ligand- mimetic therapeutics to the platelet receptor for fibrinogen
PDB Compounds: (B:) integrin beta-3

SCOPe Domain Sequences for d1tyeb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tyeb2 c.62.1.1 (B:107-354) Integrin beta A domain {Human (Homo sapiens) [TaxId: 9606]}
vedypvdiyylmdlsysmkddlwsiqnlgtklatqmrkltsnlrigfgafvdkpvspymy
isppealenpcydmkttclpmfgykhvltltdqvtrfneevkkqsvsrnrdapeggfdai
mqatvcdekigwrndashllvfttdakthialdgrlagivqpndgqchvgsdnhysastt
mdypslglmteklsqkninlifavtenvvnlyqnyselipgttvgvlsmdssnvlqlivd
aygkirsk

SCOPe Domain Coordinates for d1tyeb2:

Click to download the PDB-style file with coordinates for d1tyeb2.
(The format of our PDB-style files is described here.)

Timeline for d1tyeb2: