| Class g: Small proteins [56992] (85 folds) |
| Fold g.16: Trefoil/Plexin domain-like [57491] (3 superfamilies) disulfide-rich fold; common core is alpha+beta with two conserved disulfides |
Superfamily g.16.2: Plexin repeat [103575] (1 family) ![]() |
| Family g.16.2.1: Plexin repeat [103576] (3 proteins) Pfam PF01437 |
| Protein Integrin beta-3 [118249] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [118250] (7 PDB entries) |
| Domain d1ty7b3: 1ty7 B:1-57 [112821] Other proteins in same PDB: d1ty7a_, d1ty7b1, d1ty7b2, d1ty7h1, d1ty7h2, d1ty7l1, d1ty7l2 complexed with 180, ca, gol, man, mg, nag |
PDB Entry: 1ty7 (more details), 3.1 Å
SCOP Domain Sequences for d1ty7b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ty7b3 g.16.2.1 (B:1-57) Integrin beta-3 {Human (Homo sapiens) [TaxId: 9606]}
gpnicttrgvsscqqclavspmcawcsdealplgsprcdlkenllkdncapesiefp
Timeline for d1ty7b3: