SCOP 1.73: Domain d1ty6l2: 1ty6 L:108-214

Lineage for d1ty6l2 (1ty6 L:108-214)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)

8. Domain d1ty6l2: 1ty6 L:108-214 [112817]
   Other proteins in same PDB: d1ty6a_, d1ty6b1, d1ty6b2, d1ty6b3, d1ty6h1, d1ty6h2, d1ty6l1
   complexed with ca, gol, hrg, man, mg, mpt, nag, nh2

Details for d1ty6l2

PDB Entry: 1ty6, 2.9 Å

PDB Description: Structural basis for allostery in integrins and binding of ligand-mimetic therapeutics to the platelet receptor for fibrinogen

PDB Compounds: (L:) monoclonal antibody 10e5 light chain

SCOP Domain Sequences for d1ty6l2:

Sequence; same for both SEQRES and ATOM records:

>d1ty6l2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d1ty6l2:

• d1ty6l2 first appeared in SCOP 1.71
  
• d1ty6l2 does not appear in SCOP 1.75