Lineage for d1ty6b1 (1ty6 B:58-106,B:355-440)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 551936Superfamily b.1.15: Integrin domains [69179] (1 family) (S)
  5. 551937Family b.1.15.1: Integrin domains [69180] (2 proteins)
  6. 551938Protein Hybrid domain of integrin beta [69183] (1 species)
  7. 551939Species Human (Homo sapiens) [TaxId:9606] [69184] (10 PDB entries)
  8. 551946Domain d1ty6b1: 1ty6 B:58-106,B:355-440 [112811]
    Other proteins in same PDB: d1ty6a_, d1ty6b2, d1ty6b3, d1ty6h1, d1ty6h2, d1ty6l1, d1ty6l2
    complexed with ca, gol, hrg, man, mg, mpt, nag, nh2

Details for d1ty6b1

PDB Entry: 1ty6 (more details), 2.9 Å

PDB Description: Structural basis for allostery in integrins and binding of ligand-mimetic therapeutics to the platelet receptor for fibrinogen

SCOP Domain Sequences for d1ty6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ty6b1 b.1.15.1 (B:58-106,B:355-440) Hybrid domain of integrin beta {Human (Homo sapiens)}
vsearvledrplsdkgsgdssqvtqvspqrialrlrpddsknfsiqvrqXvelevrdlpe
elslsfnatclnnevipglkscmglkigdtvsfsieakvrgcpqekeksftikpvgfkds
livqvtfdcdcacqaq

SCOP Domain Coordinates for d1ty6b1:

Click to download the PDB-style file with coordinates for d1ty6b1.
(The format of our PDB-style files is described here.)

Timeline for d1ty6b1: