Lineage for d1ty5l2 (1ty5 L:108-214)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 549707Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 549856Species Mouse (Mus musculus) [TaxId:10090] [88567] (284 PDB entries)
  8. 550109Domain d1ty5l2: 1ty5 L:108-214 [112809]
    Other proteins in same PDB: d1ty5a_, d1ty5b1, d1ty5b2, d1ty5b3, d1ty5h1, d1ty5h2, d1ty5l1
    complexed with agg, ca, gol, man, mg, nag

Details for d1ty5l2

PDB Entry: 1ty5 (more details), 2.9 Å

PDB Description: Structural basis for allostery in integrins and binding of ligand-mimetic therapeutics to the platelet receptor for fibrinogen

SCOP Domain Sequences for d1ty5l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ty5l2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1ty5l2:

Click to download the PDB-style file with coordinates for d1ty5l2.
(The format of our PDB-style files is described here.)

Timeline for d1ty5l2: