SCOP 1.71: Domain d1ty5l1: 1ty5 L:1-107

Lineage for d1ty5l1 (1ty5 L:1-107)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (170 PDB entries)

8. Domain d1ty5l1: 1ty5 L:1-107 [112808]
   Other proteins in same PDB: d1ty5a_, d1ty5b1, d1ty5b2, d1ty5b3, d1ty5h1, d1ty5h2, d1ty5l2
   complexed with agg, ca, gol, man, mg, nag

Details for d1ty5l1

PDB Entry: 1ty5, 2.9 Å

PDB Description: Structural basis for allostery in integrins and binding of ligand-mimetic therapeutics to the platelet receptor for fibrinogen

SCOP Domain Sequences for d1ty5l1:

Sequence; same for both SEQRES and ATOM records:

>d1ty5l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
dilmtqspssmsvslgdtvsitchasqgissnigwlqqkpgksfmgliyygtnlvdgvps
rfsgsgsgadysltissldsedfadyycvqyaqlpytfgggtkleik

Timeline for d1ty5l1:

• d1ty5l1 is new in SCOP 1.71
  
• d1ty5l1 last appears in SCOP 1.73