SCOP 1.71: Domain d1ty5h2: 1ty5 H:120-219

Lineage for d1ty5h2 (1ty5 H:120-219)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (302 PDB entries)

8. Domain d1ty5h2: 1ty5 H:120-219 [112807]
   Other proteins in same PDB: d1ty5a_, d1ty5b1, d1ty5b2, d1ty5b3, d1ty5h1, d1ty5l1, d1ty5l2
   complexed with agg, ca, gol, man, mg, nag

Details for d1ty5h2

PDB Entry: 1ty5, 2.9 Å

PDB Description: Structural basis for allostery in integrins and binding of ligand-mimetic therapeutics to the platelet receptor for fibrinogen

SCOP Domain Sequences for d1ty5h2:

Sequence; same for both SEQRES and ATOM records:

>d1ty5h2 b.1.1.2 (H:120-219) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

Timeline for d1ty5h2:

• d1ty5h2 is new in SCOP 1.71
  
• d1ty5h2 last appears in SCOP 1.73