Lineage for d1ty5b3 (1ty5 B:1-57)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 749048Fold g.16: Trefoil/Plexin domain-like [57491] (3 superfamilies)
    disulfide-rich fold; common core is alpha+beta with two conserved disulfides
  4. 749077Superfamily g.16.2: Plexin repeat [103575] (1 family) (S)
  5. 749078Family g.16.2.1: Plexin repeat [103576] (3 proteins)
    Pfam PF01437
  6. 749083Protein Integrin beta-3 [118249] (1 species)
  7. 749084Species Human (Homo sapiens) [TaxId:9606] [118250] (7 PDB entries)
  8. 749088Domain d1ty5b3: 1ty5 B:1-57 [112805]
    Other proteins in same PDB: d1ty5a_, d1ty5b1, d1ty5b2, d1ty5h1, d1ty5h2, d1ty5l1, d1ty5l2
    complexed with agg, ca, gol, man, mg, nag

Details for d1ty5b3

PDB Entry: 1ty5 (more details), 2.9 Å

PDB Description: Structural basis for allostery in integrins and binding of ligand-mimetic therapeutics to the platelet receptor for fibrinogen
PDB Compounds: (B:) integrin beta-3

SCOP Domain Sequences for d1ty5b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ty5b3 g.16.2.1 (B:1-57) Integrin beta-3 {Human (Homo sapiens) [TaxId: 9606]}
gpnicttrgvsscqqclavspmcawcsdealplgsprcdlkenllkdncapesiefp

SCOP Domain Coordinates for d1ty5b3:

Click to download the PDB-style file with coordinates for d1ty5b3.
(The format of our PDB-style files is described here.)

Timeline for d1ty5b3: