SCOP 1.71: Domain d1ty5b3: 1ty5 B:1-57

Lineage for d1ty5b3 (1ty5 B:1-57)

1. Root: SCOP 1.71

2. Class g: Small proteins [56992] (79 folds)

3. Fold g.16: Trefoil/Plexin domain-like [57491] (3 superfamilies)
   disulfide-rich fold; common core is alpha+beta with two conserved disulfides

4. Superfamily g.16.2: Plexin repeat [103575] (1 family)

5. Family g.16.2.1: Plexin repeat [103576] (3 proteins)
   Pfam 01437

6. Protein Integrin beta-3 [118249] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [118250] (7 PDB entries)

8. Domain d1ty5b3: 1ty5 B:1-57 [112805]
   Other proteins in same PDB: d1ty5a_, d1ty5b1, d1ty5b2, d1ty5h1, d1ty5h2, d1ty5l1, d1ty5l2
   complexed with agg, ca, gol, man, mg, nag

Details for d1ty5b3

PDB Entry: 1ty5, 2.9 Å

PDB Description: Structural basis for allostery in integrins and binding of ligand-mimetic therapeutics to the platelet receptor for fibrinogen

SCOP Domain Sequences for d1ty5b3:

Sequence; same for both SEQRES and ATOM records:

>d1ty5b3 g.16.2.1 (B:1-57) Integrin beta-3 {Human (Homo sapiens)}
gpnicttrgvsscqqclavspmcawcsdealplgsprcdlkenllkdncapesiefp

Timeline for d1ty5b3:

• d1ty5b3 is new in SCOP 1.71
  
• d1ty5b3 last appears in SCOP 1.73