![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.62: vWA-like [53299] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.62.1: vWA-like [53300] (4 families) ![]() |
![]() | Family c.62.1.1: Integrin A (or I) domain [53301] (10 proteins) |
![]() | Protein Integrin beta A domain [69542] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [69543] (10 PDB entries) |
![]() | Domain d1ty5b2: 1ty5 B:107-354 [112804] Other proteins in same PDB: d1ty5a_, d1ty5b1, d1ty5b3, d1ty5h1, d1ty5h2, d1ty5l1, d1ty5l2 complexed with agg, ca, gol, man, mg, nag |
PDB Entry: 1ty5 (more details), 2.9 Å
SCOP Domain Sequences for d1ty5b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ty5b2 c.62.1.1 (B:107-354) Integrin beta A domain {Human (Homo sapiens)} vedypvdiyylmdlsysmkddlwsiqnlgtklatqmrkltsnlrigfgafvdkpvspymy isppealenpcydmkttclpmfgykhvltltdqvtrfneevkkqsvsrnrdapeggfdai mqatvcdekigwrndashllvfttdakthialdgrlagivqpndgqchvgsdnhysastt mdypslglmteklsqkninlifavtenvvnlyqnyselipgttvgvlsmdssnvlqlivd aygkirsk
Timeline for d1ty5b2: