Lineage for d1ty5b1 (1ty5 B:58-106,B:355-440)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 658523Superfamily b.1.15: Integrin domains [69179] (1 family) (S)
  5. 658524Family b.1.15.1: Integrin domains [69180] (2 proteins)
  6. 658525Protein Hybrid domain of integrin beta [69183] (1 species)
  7. 658526Species Human (Homo sapiens) [TaxId:9606] [69184] (10 PDB entries)
  8. 658530Domain d1ty5b1: 1ty5 B:58-106,B:355-440 [112803]
    Other proteins in same PDB: d1ty5a_, d1ty5b2, d1ty5b3, d1ty5h1, d1ty5h2, d1ty5l1, d1ty5l2
    complexed with agg, ca, gol, man, mg, nag

Details for d1ty5b1

PDB Entry: 1ty5 (more details), 2.9 Å

PDB Description: Structural basis for allostery in integrins and binding of ligand-mimetic therapeutics to the platelet receptor for fibrinogen
PDB Compounds: (B:) integrin beta-3

SCOP Domain Sequences for d1ty5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ty5b1 b.1.15.1 (B:58-106,B:355-440) Hybrid domain of integrin beta {Human (Homo sapiens) [TaxId: 9606]}
vsearvledrplsdkgsgdssqvtqvspqrialrlrpddsknfsiqvrqXvelevrdlpe
elslsfnatclnnevipglkscmglkigdtvsfsieakvrgcpqekeksftikpvgfkds
livqvtfdcdcacqaq

SCOP Domain Coordinates for d1ty5b1:

Click to download the PDB-style file with coordinates for d1ty5b1.
(The format of our PDB-style files is described here.)

Timeline for d1ty5b1: