![]() | Class g: Small proteins [56992] (85 folds) |
![]() | Fold g.16: Trefoil/Plexin domain-like [57491] (3 superfamilies) disulfide-rich fold; common core is alpha+beta with two conserved disulfides |
![]() | Superfamily g.16.2: Plexin repeat [103575] (1 family) ![]() |
![]() | Family g.16.2.1: Plexin repeat [103576] (3 proteins) Pfam PF01437 |
![]() | Protein Integrin beta-3 [118249] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [118250] (7 PDB entries) |
![]() | Domain d1ty3b3: 1ty3 B:1-57 [112797] Other proteins in same PDB: d1ty3a_, d1ty3b1, d1ty3b2, d1ty3h1, d1ty3h2, d1ty3l1, d1ty3l2 complexed with ca, cac, gol, man, mg, nag |
PDB Entry: 1ty3 (more details), 2.8 Å
SCOP Domain Sequences for d1ty3b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ty3b3 g.16.2.1 (B:1-57) Integrin beta-3 {Human (Homo sapiens) [TaxId: 9606]} gpnicttrgvsscqqclavspmcawcsdealplgsprcdlkenllkdncapesiefp
Timeline for d1ty3b3: