Lineage for d1ty3b2 (1ty3 B:107-354)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 704292Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 704293Superfamily c.62.1: vWA-like [53300] (5 families) (S)
  5. 704294Family c.62.1.1: Integrin A (or I) domain [53301] (10 proteins)
  6. 704344Protein Integrin beta A domain [69542] (1 species)
  7. 704345Species Human (Homo sapiens) [TaxId:9606] [69543] (10 PDB entries)
  8. 704347Domain d1ty3b2: 1ty3 B:107-354 [112796]
    Other proteins in same PDB: d1ty3a_, d1ty3b1, d1ty3b3, d1ty3h1, d1ty3h2, d1ty3l1, d1ty3l2
    complexed with ca, cac, gol, man, mg, nag

Details for d1ty3b2

PDB Entry: 1ty3 (more details), 2.8 Å

PDB Description: Structural basis for allostery in integrins and binding of ligand-mimetic therapeutics to the platelet receptor for fibrinogen
PDB Compounds: (B:) integrin beta-3

SCOP Domain Sequences for d1ty3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ty3b2 c.62.1.1 (B:107-354) Integrin beta A domain {Human (Homo sapiens) [TaxId: 9606]}
vedypvdiyylmdlsysmkddlwsiqnlgtklatqmrkltsnlrigfgafvdkpvspymy
isppealenpcydmkttclpmfgykhvltltdqvtrfneevkkqsvsrnrdapeggfdai
mqatvcdekigwrndashllvfttdakthialdgrlagivqpndgqchvgsdnhysastt
mdypslglmteklsqkninlifavtenvvnlyqnyselipgttvgvlsmdssnvlqlivd
aygkirsk

SCOP Domain Coordinates for d1ty3b2:

Click to download the PDB-style file with coordinates for d1ty3b2.
(The format of our PDB-style files is described here.)

Timeline for d1ty3b2: