Lineage for d1ty3a_ (1ty3 A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 675262Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 675487Superfamily b.69.8: Integrin alpha N-terminal domain [69318] (1 family) (S)
  5. 675488Family b.69.8.1: Integrin alpha N-terminal domain [69319] (1 protein)
  6. 675489Protein Integrin alpha N-terminal domain [69320] (2 species)
  7. 675490Species Human (Homo sapiens), isoform IIb [TaxId:9606] [117285] (6 PDB entries)
  8. 675492Domain d1ty3a_: 1ty3 A: [112794]
    Other proteins in same PDB: d1ty3b1, d1ty3b2, d1ty3b3, d1ty3h1, d1ty3h2, d1ty3l1, d1ty3l2
    complexed with ca, cac, gol, man, mg, nag

Details for d1ty3a_

PDB Entry: 1ty3 (more details), 2.8 Å

PDB Description: Structural basis for allostery in integrins and binding of ligand-mimetic therapeutics to the platelet receptor for fibrinogen
PDB Compounds: (A:) integrin alpha-IIb

SCOP Domain Sequences for d1ty3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ty3a_ b.69.8.1 (A:) Integrin alpha N-terminal domain {Human (Homo sapiens), isoform IIb [TaxId: 9606]}
lnldpvqltfyagpngsqfgfsldfhkdshgrvaivvgaprtlgpsqeetggvflcpwra
eggqcpsllfdlrdetrnvgsqtlqtfkarqglgasvvswsdvivacapwqhwnvlekte
eaektpvgscflaqpesgrraeyspcrgntlsriyvendfswdkryceagfssvvtqage
lvlgapggyyflgllaqapvadifssyrpgillwhvssqslsfdssnpeyfdgywgysva
vgefdgdlntteyvvgaptwswtlgaveildsyyqrlhrlraeqmasyfghsvavtdvng
dgrhdllvgaplymesradrklaevgrvylflqprgphalgapsllltgtqlygrfgsai
aplgdldrdgyndiavaapyggpsgrgqvlvflgqseglrsrpsqvldspfptgsafgfs
lrgavdiddngypdlivgayganqvavyraqp

SCOP Domain Coordinates for d1ty3a_:

Click to download the PDB-style file with coordinates for d1ty3a_.
(The format of our PDB-style files is described here.)

Timeline for d1ty3a_: