| Class b: All beta proteins [48724] (165 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
| Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries) |
| Domain d1txvh2: 1txv H:120-219 [112788] Other proteins in same PDB: d1txva_, d1txvb1, d1txvb2, d1txvb3, d1txvh1, d1txvl1, d1txvl2 complexed with ca, cac, gol, man, mg, nag |
PDB Entry: 1txv (more details), 2.75 Å
SCOP Domain Sequences for d1txvh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1txvh2 b.1.1.2 (H:120-219) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
Timeline for d1txvh2: