Lineage for d1txvh1 (1txv H:1-119)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652160Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 652522Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88551] (34 PDB entries)
  8. 652551Domain d1txvh1: 1txv H:1-119 [112787]
    Other proteins in same PDB: d1txva_, d1txvb1, d1txvb2, d1txvb3, d1txvh2, d1txvl1, d1txvl2
    complexed with ca, cac, gol, man, mg, nag

Details for d1txvh1

PDB Entry: 1txv (more details), 2.75 Å

PDB Description: Structural basis for allostery in integrins and binding of ligand-mimetic therapeutics to the platelet receptor for fibrinogen
PDB Compounds: (H:) monoclonal antibody 10e5 heavy chain

SCOP Domain Sequences for d1txvh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1txvh1 b.1.1.1 (H:1-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.1 [TaxId: 10090]}
evqlqqsgaelvkpgasvklsctasgfnikdtyvhwvkqrpeqglewigridpangytky
dpkfqgkatitadtssntaylqlssltsedtavyycvrplydyyamdywgqgtsvtvss

SCOP Domain Coordinates for d1txvh1:

Click to download the PDB-style file with coordinates for d1txvh1.
(The format of our PDB-style files is described here.)

Timeline for d1txvh1: