Class g: Small proteins [56992] (79 folds) |
Fold g.16: Trefoil/Plexin domain-like [57491] (3 superfamilies) disulfide-rich fold; common core is alpha+beta with two conserved disulfides |
Superfamily g.16.2: Plexin repeat [103575] (1 family) |
Family g.16.2.1: Plexin repeat [103576] (3 proteins) Pfam 01437 |
Protein Integrin beta-3 [118249] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [118250] (7 PDB entries) |
Domain d1txvb3: 1txv B:1-57 [112786] Other proteins in same PDB: d1txva_, d1txvb1, d1txvb2, d1txvh1, d1txvh2, d1txvl1, d1txvl2 complexed with ca, cac, gol, man, mg, nag |
PDB Entry: 1txv (more details), 2.75 Å
SCOP Domain Sequences for d1txvb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1txvb3 g.16.2.1 (B:1-57) Integrin beta-3 {Human (Homo sapiens)} gpnicttrgvsscqqclavspmcawcsdealplgsprcdlkenllkdncapesiefp
Timeline for d1txvb3: