![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.62: vWA-like [53299] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.62.1: vWA-like [53300] (5 families) ![]() |
![]() | Family c.62.1.1: Integrin A (or I) domain [53301] (10 proteins) |
![]() | Protein Integrin beta A domain [69542] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [69543] (10 PDB entries) |
![]() | Domain d1txvb2: 1txv B:107-354 [112785] Other proteins in same PDB: d1txva_, d1txvb1, d1txvb3, d1txvh1, d1txvh2, d1txvl1, d1txvl2 complexed with ca, cac, gol, man, mg, nag |
PDB Entry: 1txv (more details), 2.75 Å
SCOP Domain Sequences for d1txvb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1txvb2 c.62.1.1 (B:107-354) Integrin beta A domain {Human (Homo sapiens) [TaxId: 9606]} vedypvdiyylmdlsysmkddlwsiqnlgtklatqmrkltsnlrigfgafvdkpvspymy isppealenpcydmkttclpmfgykhvltltdqvtrfneevkkqsvsrnrdapeggfdai mqatvcdekigwrndashllvfttdakthialdgrlagivqpndgqchvgsdnhysastt mdypslglmteklsqkninlifavtenvvnlyqnyselipgttvgvlsmdssnvlqlivd aygkirsk
Timeline for d1txvb2: