Lineage for d1txvb1 (1txv B:58-106,B:355-440)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 658523Superfamily b.1.15: Integrin domains [69179] (1 family) (S)
  5. 658524Family b.1.15.1: Integrin domains [69180] (2 proteins)
  6. 658525Protein Hybrid domain of integrin beta [69183] (1 species)
  7. 658526Species Human (Homo sapiens) [TaxId:9606] [69184] (10 PDB entries)
  8. 658527Domain d1txvb1: 1txv B:58-106,B:355-440 [112784]
    Other proteins in same PDB: d1txva_, d1txvb2, d1txvb3, d1txvh1, d1txvh2, d1txvl1, d1txvl2
    complexed with ca, cac, gol, man, mg, nag

Details for d1txvb1

PDB Entry: 1txv (more details), 2.75 Å

PDB Description: Structural basis for allostery in integrins and binding of ligand-mimetic therapeutics to the platelet receptor for fibrinogen
PDB Compounds: (B:) integrin beta-3

SCOP Domain Sequences for d1txvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1txvb1 b.1.15.1 (B:58-106,B:355-440) Hybrid domain of integrin beta {Human (Homo sapiens) [TaxId: 9606]}
vsearvledrplsdkgsgdssqvtqvspqrialrlrpddsknfsiqvrqXvelevrdlpe
elslsfnatclnnevipglkscmglkigdtvsfsieakvrgcpqekeksftikpvgfkds
livqvtfdcdcacqaq

SCOP Domain Coordinates for d1txvb1:

Click to download the PDB-style file with coordinates for d1txvb1.
(The format of our PDB-style files is described here.)

Timeline for d1txvb1: