![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.15: Integrin domains [69179] (1 family) ![]() |
![]() | Family b.1.15.1: Integrin domains [69180] (2 proteins) |
![]() | Protein Hybrid domain of integrin beta [69183] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [69184] (10 PDB entries) |
![]() | Domain d1txvb1: 1txv B:58-106,B:355-440 [112784] Other proteins in same PDB: d1txva_, d1txvb2, d1txvb3, d1txvh1, d1txvh2, d1txvl1, d1txvl2 complexed with ca, cac, gol, man, mg, nag |
PDB Entry: 1txv (more details), 2.75 Å
SCOP Domain Sequences for d1txvb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1txvb1 b.1.15.1 (B:58-106,B:355-440) Hybrid domain of integrin beta {Human (Homo sapiens) [TaxId: 9606]} vsearvledrplsdkgsgdssqvtqvspqrialrlrpddsknfsiqvrqXvelevrdlpe elslsfnatclnnevipglkscmglkigdtvsfsieakvrgcpqekeksftikpvgfkds livqvtfdcdcacqaq
Timeline for d1txvb1: