Lineage for d1twhj_ (1twh J:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1078587Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1081028Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) (S)
  5. 1081029Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (2 proteins)
    Zn-binding site is near the N-terminus
  6. 1081030Protein RNA polymerase subunit RPB10 [46926] (2 species)
  7. 1081031Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63490] (27 PDB entries)
    Uniprot P22139; part of multichain biological unit
  8. 1081038Domain d1twhj_: 1twh J: [112761]
    Other proteins in same PDB: d1twha_, d1twhb_, d1twhc1, d1twhc2, d1twhe1, d1twhe2, d1twhf_, d1twhh_, d1twhi1, d1twhi2, d1twhk_, d1twhl_
    protein/RNA complex; complexed with atp, mn, zn

Details for d1twhj_

PDB Entry: 1twh (more details), 3.4 Å

PDB Description: RNA polymerase II complexed with 2'dATP
PDB Compounds: (J:) DNA-directed RNA polymerases I, II, and III 8.3 kDa polypeptide

SCOPe Domain Sequences for d1twhj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1twhj_ a.4.11.1 (J:) RNA polymerase subunit RPB10 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
lryn

SCOPe Domain Coordinates for d1twhj_:

Click to download the PDB-style file with coordinates for d1twhj_.
(The format of our PDB-style files is described here.)

Timeline for d1twhj_: