SCOPe 2.02: Domain d1twgi2: 1twg I:50-121

Lineage for d1twgi2 (1twg I:50-121)

1. Root: SCOPe 2.02

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.3: Zinc beta-ribbon [57783] (5 families)

5. Family g.41.3.1: Transcriptional factor domain [57784] (4 proteins)

6. Protein RBP9 subunit of RNA polymerase II [57787] (2 species)
   contains two differently decorated domains of this fold

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (24 PDB entries)
   Uniprot P27999; part of multichain biological unit

8. Domain d1twgi2: 1twg I:50-121 [112747]
   Other proteins in same PDB: d1twga_, d1twgb_, d1twgc1, d1twgc2, d1twge1, d1twge2, d1twgf_, d1twgh_, d1twgj_, d1twgk_, d1twgl_
   protein/RNA complex; complexed with ctp, mn, zn

Details for d1twgi2

PDB Entry: 1twg, 3.3 Å

PDB Description: RNA polymerase II complexed with CTP

PDB Compounds: (I:) DNA-directed RNA polymerase II 14.2 kDa polypeptide

SCOPe Domain Sequences for d1twgi2:

Sequence; same for both SEQRES and ATOM records:

>d1twgi2 g.41.3.1 (I:50-121) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tnigetagvvqdigsdptlprsdrecpkchsrenvffqsqqrrkdtsmvlffvclscshi
ftsdqknkrtqf

Timeline for d1twgi2:

• d1twgi2 first appeared in SCOP 1.71
  
• d1twgi2 appears in SCOPe 2.01
  
• d1twgi2 appears in SCOPe 2.03
  
• d1twgi2 appears in the current release, SCOPe 2.08