Lineage for d1twfe1 (1twf E:1-143)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 585880Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 586199Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family) (S)
  5. 586200Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (1 protein)
  6. 586201Protein Eukaryotic RPB5 N-terminal domain [53038] (1 species)
  7. 586202Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53039] (10 PDB entries)
  8. 586204Domain d1twfe1: 1twf E:1-143 [112729]
    Other proteins in same PDB: d1twfa_, d1twfb_, d1twfc1, d1twfc2, d1twfe2, d1twff_, d1twfh_, d1twfi1, d1twfi2, d1twfj_, d1twfk_, d1twfl_
    complexed with mn, utp, zn

Details for d1twfe1

PDB Entry: 1twf (more details), 2.3 Å

PDB Description: RNA polymerase II complexed with UTP at 2.3 A resolution

SCOP Domain Sequences for d1twfe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1twfe1 c.52.3.1 (E:1-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
mdqenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsf
qanpteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsa
mklvpsippatietfneaalvvn

SCOP Domain Coordinates for d1twfe1:

Click to download the PDB-style file with coordinates for d1twfe1.
(The format of our PDB-style files is described here.)

Timeline for d1twfe1: