![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.60: SAM domain-like [47768] (15 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.12: DNA polymerase beta-like, second domain [81585] (1 family) ![]() contains one classic and one pseudo HhH motifs |
![]() | Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins) topological similarity to the N-terminal domain |
![]() | Protein DNA polymerase beta [81579] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [81575] (103 PDB entries) |
![]() | Domain d1tv9a2: 1tv9 A:92-148 [112676] Other proteins in same PDB: d1tv9a1, d1tv9a3 complexed with mg, na, po4 |
PDB Entry: 1tv9 (more details), 2 Å
SCOP Domain Sequences for d1tv9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tv9a2 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens) [TaxId: 9606]} dtsssinfltrvsgigpsaarkfvdegiktledlrknedklnhhqriglkyfgdfek
Timeline for d1tv9a2: