Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (22 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins) |
Protein Class pi GST [81358] (4 species) |
Species Onchocerca volvulus [TaxId:6282] [117595] (2 PDB entries) |
Domain d1tu8c2: 1tu8 C:1-77 [112662] Other proteins in same PDB: d1tu8a1, d1tu8b1, d1tu8c1, d1tu8d1 |
PDB Entry: 1tu8 (more details), 1.8 Å
SCOP Domain Sequences for d1tu8c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tu8c2 c.47.1.5 (C:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} msykltyfsirglaepirlflvdqdikfiddriakddfssiksqfqfgqlpclydgdqqi vqsgailrhlarkynln
Timeline for d1tu8c2: