SCOP 1.73: Domain d1tu8c2: 1tu8 C:1-77

Lineage for d1tu8c2 (1tu8 C:1-77)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (22 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)

6. Protein Class pi GST [81358] (4 species)

7. Species Onchocerca volvulus [TaxId:6282] [117595] (2 PDB entries)

8. Domain d1tu8c2: 1tu8 C:1-77 [112662]
   Other proteins in same PDB: d1tu8a1, d1tu8b1, d1tu8c1, d1tu8d1

Details for d1tu8c2

PDB Entry: 1tu8, 1.8 Å

PDB Description: structure of onchoverca volvulus pi-class glutathione s-transferase with its kompetitive inhibitor s-hexyl-gsh

PDB Compounds: (C:) Glutathione S-transferase 2

SCOP Domain Sequences for d1tu8c2:

Sequence; same for both SEQRES and ATOM records:

>d1tu8c2 c.47.1.5 (C:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]}
msykltyfsirglaepirlflvdqdikfiddriakddfssiksqfqfgqlpclydgdqqi
vqsgailrhlarkynln

Timeline for d1tu8c2:

• d1tu8c2 first appeared in SCOP 1.71
  
• d1tu8c2 appears in SCOP 1.75
  
• d1tu8c2 appears in the current release, SCOPe 2.08