Lineage for d1tu8b1 (1tu8 B:78-208)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 538429Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 538430Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 538431Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)
  6. 538661Protein Class pi GST [81347] (4 species)
  7. 538763Species Onchocerca volvulus [TaxId:6282] [116911] (2 PDB entries)
  8. 538767Domain d1tu8b1: 1tu8 B:78-208 [112659]
    Other proteins in same PDB: d1tu8a2, d1tu8b2, d1tu8c2, d1tu8d2

Details for d1tu8b1

PDB Entry: 1tu8 (more details), 1.8 Å

PDB Description: structure of onchoverca volvulus pi-class glutathione s-transferase with its kompetitive inhibitor s-hexyl-gsh

SCOP Domain Sequences for d1tu8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tu8b1 a.45.1.1 (B:78-208) Class pi GST {Onchocerca volvulus}
genemettyidmfcegvrdlhvkytrmiymayetekdpyiksilpgelakfekllatrgn
grnlilgdkisyadyalfeeldvhqildphcldkfpllkvfhqrmkdrpklkeycekrda
akvpvngngkq

SCOP Domain Coordinates for d1tu8b1:

Click to download the PDB-style file with coordinates for d1tu8b1.
(The format of our PDB-style files is described here.)

Timeline for d1tu8b1: