Class f: Membrane and cell surface proteins and peptides [56835] (50 folds) |
Fold f.19: Aquaporin-like [81339] (1 superfamily) core: 8 helices, 2 short helices are surrounded by 6 long transmembrane helices |
Superfamily f.19.1: Aquaporin-like [81338] (1 family) |
Family f.19.1.1: Aquaporin-like [56895] (4 proteins) duplication: consist of two similar structural parts |
Protein Aquaporin-0 [103468] (2 species) |
Species Cow (Bos taurus) [TaxId:9913] [118226] (1 PDB entry) |
Domain d1tm8a_: 1tm8 A: [112520] complexed with bng |
PDB Entry: 1tm8 (more details), 2.24 Å
SCOP Domain Sequences for d1tm8a_:
Sequence, based on SEQRES records: (download)
>d1tm8a_ f.19.1.1 (A:) Aquaporin-0 {Cow (Bos taurus) [TaxId: 9913]} sasfwraicaeffaslfyvffglgaslrwapgplhvlqvalafglalatlvqavghisga hvnpavtfaflvgsqmsllraicymvaqllgavagaavlysvtppavrgnlalntlhpgv svgqativeifltlqfvlcifatyderrngrlgsvalavgfsltlghlfgmyytgagmnp arsfapailtrnftnhwvywvgpvigaglgsllydfllfprlksvserlsilkg
>d1tm8a_ f.19.1.1 (A:) Aquaporin-0 {Cow (Bos taurus) [TaxId: 9913]} sasfwraicaeffaslfyvffglgaslrwagplhvlqvalafglalatlvqavghisgah vnpavtfaflvgsqmsllraicymvaqllgavagaavlysvtppavrgnlalntlhpgvs vgqativeifltlqfvlcifatyderrngrlgsvalavgfsltlghlfgmyytgagmnpa rsfapailtrnftnhwvywvgpvigaglgsllydfllfprlksvserlsilkg
Timeline for d1tm8a_: