Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily) alpha+beta sandwich; loop across free side of beta-sheet |
Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families) |
Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 proteins) automatically mapped to Pfam PF00280 |
Protein Chymotrypsin inhibitor CI-2 [54658] (1 species) |
Species Barley (Hordeum vulgare) [TaxId:4513] [54659] (29 PDB entries) Uniprot Q40059 22-84 |
Domain d1tm3i_: 1tm3 I: [112512] Other proteins in same PDB: d1tm3e1, d1tm3e2 complexed with 1pe, ca, cit, na; mutant |
PDB Entry: 1tm3 (more details), 1.57 Å
SCOPe Domain Sequences for d1tm3i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tm3i_ d.40.1.1 (I:) Chymotrypsin inhibitor CI-2 {Barley (Hordeum vulgare) [TaxId: 4513]} mktewpelvgksveeakkvilqdkpaaqiivlpvgtivtkeyridrvrlfvdrldniaqv prvg
Timeline for d1tm3i_: