Lineage for d1tl7b_ (1tl7 B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2197663Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2197664Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (6 proteins)
    Pfam PF00211
    structurally similar to the "palm" domain of DNA/RNA polymerase superfamily
  6. 2197713Protein Type II adenylyl cyclase C2 domain [55075] (1 species)
  7. 2197714Species Norway rat (Rattus norvegicus) [TaxId:10116] [55076] (9 PDB entries)
    Uniprot P26769 879-1077
  8. 2197720Domain d1tl7b_: 1tl7 B: [112502]
    Other proteins in same PDB: d1tl7a_, d1tl7c1, d1tl7c2
    complexed with cl, fok, gsp, mg, mn, onm

Details for d1tl7b_

PDB Entry: 1tl7 (more details), 2.8 Å

PDB Description: Complex Of Gs- With The Catalytic Domains Of Mammalian Adenylyl Cyclase: Complex With 2'(3')-O-(N-methylanthraniloyl)-guanosine 5'-triphosphate and Mn
PDB Compounds: (B:) adenylate cyclase, type II

SCOPe Domain Sequences for d1tl7b_:

Sequence, based on SEQRES records: (download)

>d1tl7b_ d.58.29.1 (B:) Type II adenylyl cyclase C2 domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
hqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgvekik
tigstymaatglsaipsqehaqeperqymhigtmvefayalvgkldainkhsfndfklrv
ginhgpviagvigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytctc
rgiinvkgkgdlktyfvnt

Sequence, based on observed residues (ATOM records): (download)

>d1tl7b_ d.58.29.1 (B:) Type II adenylyl cyclase C2 domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
hqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgvekik
tigstymaatglsairqymhigtmvefayalvgkldainkhsfndfklrvginhgpviag
vigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytctcrgiinvkgkg
dlktyfvnt

SCOPe Domain Coordinates for d1tl7b_:

Click to download the PDB-style file with coordinates for d1tl7b_.
(The format of our PDB-style files is described here.)

Timeline for d1tl7b_: