SCOP 1.71: Domain d1tl3a1: 1tl3 A:430-537

Lineage for d1tl3a1 (1tl3 A:430-537)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (10 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (3 proteins)

6. Protein HIV RNase H (Domain of reverse transcriptase) [53105] (2 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (85 PDB entries)

8. Domain d1tl3a1: 1tl3 A:430-537 [112496]
   Other proteins in same PDB: d1tl3a2, d1tl3b1
   complexed with h20, po4

Details for d1tl3a1

PDB Entry: 1tl3, 2.8 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase in complex with gw450557

SCOP Domain Sequences for d1tl3a1:

Sequence, based on SEQRES records:

>d1tl3a1 c.55.3.1 (A:430-537) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvp

Sequence, based on observed residues (ATOM records):

>d1tl3a1 c.55.3.1 (A:430-537) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
ekepivgaetfyvdagyvtnrgrqkvvtltdttnqktelqaiylalqdsglevnivtdsq
yalgiiqaqpdqseselvnqiieqlikkekvylawvp

Timeline for d1tl3a1:

• d1tl3a1 is new in SCOP 1.71
  
• d1tl3a1 appears in SCOP 1.73
  
• d1tl3a1 appears in the current release, SCOPe 2.08