Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.2: Reverse transcriptase [56686] (3 proteins) |
Protein HIV-1 reverse transcriptase [56689] (4 species) |
Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (206 PDB entries) Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595 |
Domain d1tl1a2: 1tl1 A:7-427 [112494] Other proteins in same PDB: d1tl1a1 complexed with h18, po4 |
PDB Entry: 1tl1 (more details), 2.9 Å
SCOPe Domain Sequences for d1tl1a2:
Sequence, based on SEQRES records: (download)
>d1tl1a2 e.8.1.2 (A:7-427) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]} tvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaikkk dstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpldedfrk ytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqymdd lyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtvqpivl pekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeaelelaen reilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtndvk qlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplvklw y
>d1tl1a2 e.8.1.2 (A:7-427) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]} tvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaikwr klvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpldedfrkytafti psinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqymddlyvgsd leigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtvqpivlpekdsw tvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeaelelaenreilke pvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtndvkqlteav qkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplvklwy
Timeline for d1tl1a2: