Lineage for d1tkpd_ (1tkp D:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 638518Fold a.25: Ferritin-like [47239] (4 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 638519Superfamily a.25.1: Ferritin-like [47240] (5 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 638520Family a.25.1.1: Ferritin [47241] (9 proteins)
  6. 638728Protein Dodecameric ferritin homolog [47250] (13 species)
  7. 638736Species Archaeon Halobacterium salinarum [TaxId:2242] [101135] (5 PDB entries)
  8. 638752Domain d1tkpd_: 1tkp D: [112481]
    complexed with fe, na, so4

Details for d1tkpd_

PDB Entry: 1tkp (more details), 2.2 Å

PDB Description: iron-oxo clusters biomineralizing on protein surfaces. structural analysis of h.salinarum dpsa in its low and high iron states
PDB Compounds: (D:) Iron-rich dpsA-homolog protein

SCOP Domain Sequences for d1tkpd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tkpd_ a.25.1.1 (D:) Dodecameric ferritin homolog {Archaeon Halobacterium salinarum [TaxId: 2242]}
aratagevegsdalrmdadraeqcvdalnadlanvyvlyhqlkkhhwnvegaefrdlhlf
lgeaaetaeevadelaervqalggvphaspetlqaeasvdvededvydirtslandmaiy
gdiieatrehtelaenlgdhatahmlreglieleddahhiehyleddtlvtqgal

SCOP Domain Coordinates for d1tkpd_:

Click to download the PDB-style file with coordinates for d1tkpd_.
(The format of our PDB-style files is described here.)

Timeline for d1tkpd_: