Lineage for d1tjih1 (1tji H:1-113)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 781740Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 781741Species Engineered (including hybrid species) [88562] (67 PDB entries)
    SQ NA # humanized antidoby; bactericidal Fab-h6831
    SQ NA # humanized antibody
    SQ NA # Humanized antibody
    SQ NA # engineered antibody
    SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # humanized antibody ! SQ NA # Humanized antibody ! SQ NA # engineered antibody
  8. 781753Domain d1tjih1: 1tji H:1-113 [112454]
    Other proteins in same PDB: d1tjih2, d1tjil1, d1tjil2
    complexed with egl, ioh, nh2, ycm

Details for d1tjih1

PDB Entry: 1tji (more details), 2.2 Å

PDB Description: Crystal Structure of the broadly neutralizing anti-HIV-1 antibody 2F5 in complex with a gp41 17mer epitope
PDB Compounds: (H:) anti-HIV-1 antibody 2F5 Heavy Chain

SCOP Domain Sequences for d1tjih1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tjih1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
ritlkesgpplvkptqtltltcsfsgfslsdfgvgvgwirqppgkalewlaiiysdddkr
yspslntrltitkdtsknqvvlvmtrvspvdtatyfcahrrgpttlfgvpiargpvnamd
vwgqgitvtiss

SCOP Domain Coordinates for d1tjih1:

Click to download the PDB-style file with coordinates for d1tjih1.
(The format of our PDB-style files is described here.)

Timeline for d1tjih1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tjih2