SCOP 1.73: Domain d1tjih1: 1tji H:1-113

Lineage for d1tjih1 (1tji H:1-113)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88562] (66 PDB entries)

8. Domain d1tjih1: 1tji H:1-113 [112454]
   Other proteins in same PDB: d1tjih2, d1tjil1, d1tjil2
   complexed with egl, ioh, nh2, ycm

Details for d1tjih1

PDB Entry: 1tji, 2.2 Å

PDB Description: Crystal Structure of the broadly neutralizing anti-HIV-1 antibody 2F5 in complex with a gp41 17mer epitope

PDB Compounds: (H:) anti-HIV-1 antibody 2F5 Heavy Chain

SCOP Domain Sequences for d1tjih1:

Sequence; same for both SEQRES and ATOM records:

>d1tjih1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
ritlkesgpplvkptqtltltcsfsgfslsdfgvgvgwirqppgkalewlaiiysdddkr
yspslntrltitkdtsknqvvlvmtrvspvdtatyfcahrrgpttlfgvpiargpvnamd
vwgqgitvtiss

Timeline for d1tjih1:

• d1tjih1 first appeared in SCOP 1.71
  
• d1tjih1 appears in SCOP 1.75
  
• d1tjih1 appears in the current release, SCOPe 2.08