Lineage for d1tjhl1 (1tjh L:1-107)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1756616Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1756617Species Engineered (including hybrid species) [88533] (61 PDB entries)
    SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # Humanized antibody ! SQ NA # humanized antibody ! SQ NA # engineered antibody
  8. 1756629Domain d1tjhl1: 1tjh L:1-107 [112452]
    Other proteins in same PDB: d1tjhh1, d1tjhh2, d1tjhl2
    complexed with edo, ipa

Details for d1tjhl1

PDB Entry: 1tjh (more details), 2.1 Å

PDB Description: Crystal Structure of the broadly neutralizing anti-HIV-1 antibody 2F5 in complex with a gp41 11mer epitope
PDB Compounds: (L:) anti-HIV-1 antibody 2F5 Light Chain

SCOPe Domain Sequences for d1tjhl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tjhl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
alqltqspsslsasvgdrititcrasqgvtsalawyrqkpgsppqlliydasslesgvps
rfsgsgsgteftltistlrpedfatyycqqlhfyphtfgggtrvdvr

SCOPe Domain Coordinates for d1tjhl1:

Click to download the PDB-style file with coordinates for d1tjhl1.
(The format of our PDB-style files is described here.)

Timeline for d1tjhl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tjhl2