SCOPe 2.07: Domain d1tjgl1: 1tjg L:1-107

Lineage for d1tjgl1 (1tjg L:1-107)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88533] (63 PDB entries)
   SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # Humanized antibody ! SQ NA # humanized antibody ! SQ NA # engineered antibody

8. Domain d1tjgl1: 1tjg L:1-107 [112448]
   Other proteins in same PDB: d1tjgh1, d1tjgh2, d1tjgl2
   complexed with edo, ipa

Details for d1tjgl1

PDB Entry: 1tjg, 2 Å

PDB Description: Crystal Structure of the broadly neutralizing anti-HIV-1 antibody 2F5 in complex with a gp41 7mer epitope

PDB Compounds: (L:) FAB 2F5 Light Chain

SCOPe Domain Sequences for d1tjgl1:

Sequence; same for both SEQRES and ATOM records:

>d1tjgl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
alqltqspsslsasvgdrititcrasqgvtsalawyrqkpgsppqlliydasslesgvps
rfsgsgsgteftltistlrpedfatyycqqlhfyphtfgggtrvdvr

Timeline for d1tjgl1:

• d1tjgl1 first appeared in SCOP 1.71
  
• d1tjgl1 appears in SCOPe 2.06
  
• d1tjgl1 appears in the current release, SCOPe 2.08