Lineage for d1telb2 (1tel B:2001-2145)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2952777Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2952778Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 2952779Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (13 species)
  7. 2952785Species Chlorobium tepidum [TaxId:1097] [117975] (2 PDB entries)
    Uniprot Q8KBL4 1-428
  8. 2952789Domain d1telb2: 1tel B:2001-2145 [112408]
    Other proteins in same PDB: d1tela1, d1telb1

Details for d1telb2

PDB Entry: 1tel (more details), 2.7 Å

PDB Description: crystal structure of a rubisco-like protein from chlorobium tepidum
PDB Compounds: (B:) ribulose bisphosphate carboxylase, large subunit

SCOPe Domain Sequences for d1telb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1telb2 d.58.9.1 (B:2001-2145) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlorobium tepidum [TaxId: 1097]}
mnaedvkgffasresldmeqylvldyylesvgdietalahfcseqstaqwkrvgvdedfr
lvhaakvidyevieeleqlsypvkhsetgkihacrvtiahphcnfgpkipnlltavcgeg
tyftpgvpvvklmdihfpdtyladf

SCOPe Domain Coordinates for d1telb2:

Click to download the PDB-style file with coordinates for d1telb2.
(The format of our PDB-style files is described here.)

Timeline for d1telb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1telb1