Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) C-terminal domain is beta/alpha barrel |
Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein) |
Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species) |
Species Chlorobium tepidum [TaxId:1097] [117975] (2 PDB entries) Uniprot Q8KBL4 1-428 |
Domain d1tela2: 1tel A:1001-1145 [112406] Other proteins in same PDB: d1tela1, d1telb1 |
PDB Entry: 1tel (more details), 2.7 Å
SCOPe Domain Sequences for d1tela2:
Sequence, based on SEQRES records: (download)
>d1tela2 d.58.9.1 (A:1001-1145) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlorobium tepidum [TaxId: 1097]} mnaedvkgffasresldmeqylvldyylesvgdietalahfcseqstaqwkrvgvdedfr lvhaakvidyevieeleqlsypvkhsetgkihacrvtiahphcnfgpkipnlltavcgeg tyftpgvpvvklmdihfpdtyladf
>d1tela2 d.58.9.1 (A:1001-1145) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlorobium tepidum [TaxId: 1097]} mnaedvkgffasresldmeqylvldyylesvgdietalahfcseqstaqwkrvgvdedfr lvhaakvidyevieeleqlsypvkgkihacrvtiahphcnfgpkipnlltavcgegtyft pgvpvvklmdihfpdtyladf
Timeline for d1tela2: