SCOPe 2.05: Domain d1te0b1: 1te0 B:255-354

Lineage for d1te0b1 (1te0 B:255-354)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.4: HtrA-like serine proteases [74933] (4 proteins)

6. Protein Stress sensor protease DegS, C-terminal domain [110188] (1 species)

7. Species Escherichia coli [TaxId:562] [110189] (6 PDB entries)
   Uniprot P31137 37-354 ! Uniprot P31137

8. Domain d1te0b1: 1te0 B:255-354 [112402]
   Other proteins in same PDB: d1te0a2, d1te0b2

Details for d1te0b1

PDB Entry: 1te0, 2.2 Å

PDB Description: Structural analysis of DegS, a stress sensor of the bacterial periplasm

PDB Compounds: (B:) Protease degS

SCOPe Domain Sequences for d1te0b1:

Sequence; same for both SEQRES and ATOM records:

>d1te0b1 b.36.1.4 (B:255-354) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]}
irgyigiggreiaplhaqgggidqlqgivvnevspdgpaanagiqvndliisvdnkpais
aletmdqvaeirpgsvipvvvmrddkqltlqvtiqeypat

Timeline for d1te0b1:

• d1te0b1 first appeared in SCOP 1.71
  
• d1te0b1 appears in SCOPe 2.04
  
• d1te0b1 appears in SCOPe 2.06
  
• d1te0b1 appears in the current release, SCOPe 2.08