Lineage for d1taed_ (1tae D:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 611545Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 611763Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (4 families) (S)
    has a circularly permuted topology
  5. 611774Family d.142.2.2: Adenylation domain of NAD+-dependent DNA ligase [56096] (1 protein)
  6. 611775Protein Adenylation domain of NAD+-dependent DNA ligase [56097] (3 species)
    contains additional, N-terminal all-alpha subdomain
  7. 611779Species Enterococcus faecalis [TaxId:1351] [118124] (2 PDB entries)
  8. 611784Domain d1taed_: 1tae D: [112379]
    complexed with na, nad, so4

Details for d1taed_

PDB Entry: 1tae (more details), 2.7 Å

PDB Description: Structural rearrangement accompanying NAD+ synthesis within a bacterial DNA ligase crystal

SCOP Domain Sequences for d1taed_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1taed_ d.142.2.2 (D:) Adenylation domain of NAD+-dependent DNA ligase {Enterococcus faecalis}
qpltltaattraqelrkqlnqysheyyvkdqpsvedyvydrlykelvdietefpdlitpd
sptqrvggkvlsgfekaphdipmyslndgfskedifafdervrkaigkpvayccelkidg
laislryengvfvrgatrgdgtvgenitenlrtvrsvpmrltepisvevrgecympkqsf
valneereengqdifanprnaaagslrqldtkivakrnlntflytvadfgpmkaktqfea
leelsaigfrtnperqlcqsidevwayieeyhekrstlpyeidgivikvnefalqdelgf
tvkaprwaiaykfppeeaetv

SCOP Domain Coordinates for d1taed_:

Click to download the PDB-style file with coordinates for d1taed_.
(The format of our PDB-style files is described here.)

Timeline for d1taed_: