Lineage for d1taeb_ (1tae B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1219586Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1219875Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (4 families) (S)
    has a circularly permuted topology
  5. 1219891Family d.142.2.2: Adenylation domain of NAD+-dependent DNA ligase [56096] (2 proteins)
  6. 1219892Protein Adenylation domain of NAD+-dependent DNA ligase [56097] (4 species)
    contains additional, N-terminal all-alpha subdomain
  7. 1219896Species Enterococcus faecalis [TaxId:1351] [118124] (6 PDB entries)
    Uniprot Q837V6 5-317
  8. 1219903Domain d1taeb_: 1tae B: [112377]
    complexed with na, nad, so4

Details for d1taeb_

PDB Entry: 1tae (more details), 2.7 Å

PDB Description: Structural rearrangement accompanying NAD+ synthesis within a bacterial DNA ligase crystal
PDB Compounds: (B:) DNA ligase, NAD-dependent

SCOPe Domain Sequences for d1taeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1taeb_ d.142.2.2 (B:) Adenylation domain of NAD+-dependent DNA ligase {Enterococcus faecalis [TaxId: 1351]}
qpltltaattraqelrkqlnqysheyyvkdqpsvedyvydrlykelvdietefpdlitpd
sptqrvggkvlsgfekaphdipmyslndgfskedifafdervrkaigkpvayccelkidg
laislryengvfvrgatrgdgtvgenitenlrtvrsvpmrltepisvevrgecympkqsf
valneereengqdifanprnaaagslrqldtkivakrnlntflytvadfgpmkaktqfea
leelsaigfrtnperqlcqsidevwayieeyhekrstlpyeidgivikvnefalqdelgf
tvkaprwaiaykfppeeaetv

SCOPe Domain Coordinates for d1taeb_:

Click to download the PDB-style file with coordinates for d1taeb_.
(The format of our PDB-style files is described here.)

Timeline for d1taeb_: