Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (4 families) has a circularly permuted topology |
Family d.142.2.2: Adenylation domain of NAD+-dependent DNA ligase [56096] (1 protein) |
Protein Adenylation domain of NAD+-dependent DNA ligase [56097] (3 species) contains additional, N-terminal all-alpha subdomain |
Species Enterococcus faecalis [TaxId:1351] [118124] (2 PDB entries) |
Domain d1taeb_: 1tae B: [112377] |
PDB Entry: 1tae (more details), 2.7 Å
SCOP Domain Sequences for d1taeb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1taeb_ d.142.2.2 (B:) Adenylation domain of NAD+-dependent DNA ligase {Enterococcus faecalis [TaxId: 1351]} qpltltaattraqelrkqlnqysheyyvkdqpsvedyvydrlykelvdietefpdlitpd sptqrvggkvlsgfekaphdipmyslndgfskedifafdervrkaigkpvayccelkidg laislryengvfvrgatrgdgtvgenitenlrtvrsvpmrltepisvevrgecympkqsf valneereengqdifanprnaaagslrqldtkivakrnlntflytvadfgpmkaktqfea leelsaigfrtnperqlcqsidevwayieeyhekrstlpyeidgivikvnefalqdelgf tvkaprwaiaykfppeeaetv
Timeline for d1taeb_: