Lineage for d1t9pc_ (1t9p C:)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 624613Fold g.41: Rubredoxin-like [57769] (14 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 624740Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 624741Family g.41.5.1: Rubredoxin [57803] (3 proteins)
  6. 624742Protein Rubredoxin [57804] (6 species)
  7. 624755Species Clostridium pasteurianum [TaxId:1501] [57808] (23 PDB entries)
  8. 624773Domain d1t9pc_: 1t9p C: [112371]
    complexed with fe; mutant

Details for d1t9pc_

PDB Entry: 1t9p (more details), 1.5 Å

PDB Description: Crystal Structure of V44A, G45P Cp Rubredoxin

SCOP Domain Sequences for d1t9pc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t9pc_ g.41.5.1 (C:) Rubredoxin {Clostridium pasteurianum}
mkkytctvcgyiynpedgdpdngvnpgtdfkdipddwvcplcgapkdqfeevee

SCOP Domain Coordinates for d1t9pc_:

Click to download the PDB-style file with coordinates for d1t9pc_.
(The format of our PDB-style files is described here.)

Timeline for d1t9pc_: