SCOPe 2.05: Domain d1t9oc_: 1t9o C:

Lineage for d1t9oc_ (1t9o C:)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.5: Rubredoxin-like [57802] (4 families)

5. Family g.41.5.1: Rubredoxin [57803] (5 proteins)

6. Protein Rubredoxin [57804] (8 species)

7. Species Clostridium pasteurianum [TaxId:1501] [57808] (23 PDB entries)
   Uniprot P00268

8. Domain d1t9oc_: 1t9o C: [112368]
   complexed with fe

Details for d1t9oc_

PDB Entry: 1t9o, 2 Å

PDB Description: crystal structure of v44g cp rubredoxin

PDB Compounds: (C:) rubredoxin

SCOPe Domain Sequences for d1t9oc_:

Sequence; same for both SEQRES and ATOM records:

>d1t9oc_ g.41.5.1 (C:) Rubredoxin {Clostridium pasteurianum [TaxId: 1501]}
mkkytctvcgyiynpedgdpdngvnpgtdfkdipddwvcplcgggkdqfeeve

Timeline for d1t9oc_:

• d1t9oc_ first appeared in SCOP 1.71
  
• d1t9oc_ appears in SCOPe 2.04
  
• d1t9oc_ appears in SCOPe 2.06
  
• d1t9oc_ appears in the current release, SCOPe 2.08