Lineage for d1t9ha1 (1t9h A:1-67)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 558996Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 559685Superfamily b.40.4: Nucleic acid-binding proteins [50249] (13 families) (S)
  5. 559965Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (22 proteins)
    barrel, closed; n=5, S=8
  6. 560056Protein Probable GTPase EngC (YjeQ), N-terminal domain [110200] (2 species)
  7. 560057Species Bacillus subtilis [TaxId:1423] [117197] (1 PDB entry)
  8. 560058Domain d1t9ha1: 1t9h A:1-67 [112358]
    Other proteins in same PDB: d1t9ha2
    complexed with act, ca, ium, zn

Details for d1t9ha1

PDB Entry: 1t9h (more details), 1.6 Å

PDB Description: The crystal structure of YloQ, a circularly permuted GTPase.

SCOP Domain Sequences for d1t9ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t9ha1 b.40.4.5 (A:1-67) Probable GTPase EngC (YjeQ), N-terminal domain {Bacillus subtilis}
mpegkiikalsgfyyvldesedsdkviqcrgrgifrknkitplvgdyvvyqaendkegyl
meikert

SCOP Domain Coordinates for d1t9ha1:

Click to download the PDB-style file with coordinates for d1t9ha1.
(The format of our PDB-style files is described here.)

Timeline for d1t9ha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t9ha2