SCOP 1.73: Domain d1t9bb1: 1t9b B:290-460

Lineage for d1t9bb1 (1t9b B:290-460)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (6 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins)
   N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold

6. Protein Acetohydroxyacid synthase catalytic subunit [69463] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [69464] (6 PDB entries)

8. Domain d1t9bb1: 1t9b B:290-460 [112337]
   Other proteins in same PDB: d1t9ba2, d1t9ba3, d1t9bb2, d1t9bb3
   complexed with 1cs, fad, k, mg, nsp, p22, p25, yf3

Details for d1t9bb1

PDB Entry: 1t9b, 2.2 Å

PDB Description: crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron

PDB Compounds: (B:) Acetolactate synthase, mitochondrial

SCOP Domain Sequences for d1t9bb1:

Sequence; same for both SEQRES and ATOM records:

>d1t9bb1 c.31.1.3 (B:290-460) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nkaadlinlakkpvlyvgagilnhadgprllkelsdraqipvtttlqglgsfdqedpksl
dmlgmhgcatanlavqnadliiavgarfddrvtgniskfapearraaaegrggiihfevs
pkninkvvqtqiavegdattnlgkmmskifpvkersewfaqinkwkkeypy

Timeline for d1t9bb1:

• d1t9bb1 first appeared in SCOP 1.71
  
• d1t9bb1 appears in SCOP 1.75
  
• d1t9bb1 appears in the current release, SCOPe 2.08