SCOPe 2.06: Domain d1t9ab1: 1t9a B:281-460

Lineage for d1t9ab1 (1t9a B:281-460)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins)
   N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold

6. Protein Acetohydroxyacid synthase catalytic subunit [69463] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [69464] (10 PDB entries)
   Uniprot P07342 84-687

8. Domain d1t9ab1: 1t9a B:281-460 [112331]
   Other proteins in same PDB: d1t9aa2, d1t9aa3, d1t9ab2, d1t9ab3
   complexed with 1tb, fad, k, mg, p23, yf3, yf4

Details for d1t9ab1

PDB Entry: 1t9a, 2.59 Å

PDB Description: crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl

PDB Compounds: (B:) Acetolactate synthase, mitochondrial

SCOPe Domain Sequences for d1t9ab1:

Sequence; same for both SEQRES and ATOM records:

>d1t9ab1 c.31.1.3 (B:281-460) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qdefvmqsinkaadlinlakkpvlyvgagilnhadgprllkelsdraqipvtttlqglgs
fdqedpksldmlgmhgcatanlavqnadliiavgarfddrvtgniskfapearraaaegr
ggiihfevspkninkvvqtqiavegdattnlgkmmskifpvkersewfaqinkwkkeypy

Timeline for d1t9ab1:

• d1t9ab1 first appeared in SCOP 1.71
  
• d1t9ab1 appears in SCOPe 2.05
  
• d1t9ab1 appears in SCOPe 2.07
  
• d1t9ab1 appears in the current release, SCOPe 2.08