SCOP 1.73: Domain d1t8eb_: 1t8e B:

Lineage for d1t8eb_ (1t8e B:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (22 families)

5. Family c.47.1.1: Thioltransferase [52834] (15 proteins)

6. Protein Thioredoxin [52835] (12 species)

7. Species Escherichia coli [TaxId:562] [52836] (29 PDB entries)

8. Domain d1t8eb_: 1t8e B: [112318]
   Other proteins in same PDB: d1t8ea1, d1t8ea2
   complexed with 2dt, dct, mes, mg, pg4, so4

Details for d1t8eb_

PDB Entry: 1t8e, 2.54 Å

PDB Description: T7 DNA Polymerase Ternary Complex with dCTP at the Insertion Site.

PDB Compounds: (B:) Thioredoxin 1

SCOP Domain Sequences for d1t8eb_:

Sequence; same for both SEQRES and ATOM records:

>d1t8eb_ c.47.1.1 (B:) Thioredoxin {Escherichia coli [TaxId: 562]}
dkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnid
qnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanl

Timeline for d1t8eb_:

• d1t8eb_ first appeared in SCOP 1.71
  
• d1t8eb_ appears in SCOP 1.75
  
• d1t8eb_ appears in the current release, SCOPe 2.08