SCOP 1.71: Domain d1t7ya1: 1t7y A:184-277

Lineage for d1t7ya1 (1t7y A:184-277)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain [48965] (1 species)
   fat depleting factor related to class I MHC

7. Species Human (Homo sapiens) [TaxId:9606] [48966] (7 PDB entries)

8. Domain d1t7ya1: 1t7y A:184-277 [112308]
   Other proteins in same PDB: d1t7ya2
   complexed with nag; mutant

Details for d1t7ya1

PDB Entry: 1t7y, 2.8 Å

PDB Description: zn-alpha-2-glycoprotein; baculo-zag peg 200, no glycerol

SCOP Domain Sequences for d1t7ya1:

Sequence; same for both SEQRES and ATOM records:

>d1t7ya1 b.1.1.2 (A:184-277) Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Human (Homo sapiens)}
qdppsvvvtshqapgekkklkclaydfypgkidvhwtragevqepelrgdvlhngngtyq
swvvvavppqdtapyschvqhsslaqplvvpwea

Timeline for d1t7ya1:

• d1t7ya1 is new in SCOP 1.71
  
• d1t7ya1 appears in SCOP 1.73
  
• d1t7ya1 appears in the current release, SCOPe 2.08