Lineage for d1t7va2 (1t7v A:5-183)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2182597Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2183536Protein Zinc-alpha-2-glycoprotein, ZAG [54487] (1 species)
    fat depleting factor related to class I MHC
  7. 2183537Species Human (Homo sapiens) [TaxId:9606] [54488] (7 PDB entries)
    Uniprot P25311 22-294
  8. 2183538Domain d1t7va2: 1t7v A:5-183 [112303]
    Other proteins in same PDB: d1t7va1
    complexed with nag, p6g

Details for d1t7va2

PDB Entry: 1t7v (more details), 1.95 Å

PDB Description: zn-alpha-2-glycoprotein; baculo-zag peg 200
PDB Compounds: (A:) Zinc-alpha-2-glycoprotein

SCOPe Domain Sequences for d1t7va2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t7va2 d.19.1.1 (A:5-183) Zinc-alpha-2-glycoprotein, ZAG {Human (Homo sapiens) [TaxId: 9606]}
dgrysltyiytglskhvedvpafqalgslndlqffrynskdrksqpmglwrqvegmedwk
qdsqlqkaredifmetlkdiveyykdstgshvlqgrfgceiennrssgafwkyyydgkdy
iefnkeipawvpfdpaaqitkqkweaepvyvqrakayleeecpatlrkylkysknildr

SCOPe Domain Coordinates for d1t7va2:

Click to download the PDB-style file with coordinates for d1t7va2.
(The format of our PDB-style files is described here.)

Timeline for d1t7va2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t7va1