SCOPe 2.06: Domain d1t3va_: 1t3v A:

Lineage for d1t3va_ (1t3v A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.5: Nitrogenase accessory factor-like [53146] (3 families)

5. Family c.55.5.1: MTH1175-like [53147] (3 proteins)

6. Protein Hypothetical protein TM1816 [82446] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [82447] (2 PDB entries)
   Uniprot Q9X2D6 1-115

8. Domain d1t3va_: 1t3v A: [112232]
   Structural genomics target

Details for d1t3va_

PDB Entry: 1t3v

PDB Description: the nmr solution structure of tm1816

PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d1t3va_:

Sequence; same for both SEQRES and ATOM records:

>d1t3va_ c.55.5.1 (A:) Hypothetical protein TM1816 {Thermotoga maritima [TaxId: 2336]}
miiaipvsenrgkdspisehfgrapyfafvkvknnaiadisveenplaqdhvhgavpnfv
kekgaelvivrgigrraiaafeamgvkvikgasgtveevvnqylsgqlkdsdyevhdhhh
hehh

Timeline for d1t3va_:

• d1t3va_ first appeared in SCOP 1.71
  
• d1t3va_ appears in SCOPe 2.05
  
• d1t3va_ appears in SCOPe 2.07
  
• d1t3va_ appears in the current release, SCOPe 2.08